PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009110765.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 246aa    MW: 28960 Da    PI: 7.9306
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009110765.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK74.71.1e-23126175352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     k +s e++s y+++pi++AAkeL+++lT+LK++CR +GI+RWPhRk  sl
  XP_009110765.1 126 KPLSKETISLYYDMPIAQAAKELNIGLTLLKKKCRDLGIQRWPHRKFMSL 175
                     67999*****************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.37106195IPR003035RWP-RK domain
PfamPF020423.7E-19128175IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MMNSFSSLEC DKVFDKEDKP FSFLEYFSYQ SEFTNNFFGL EDEIISSGNY DYYLPSASNF  60
LALPDLEPIS IVSHEDLLNE YGSVSWTEKE SMFDEHQRED FDLVKKTETV KKRVREECAY  120
SSYVAKPLSK ETISLYYDMP IAQAAKELNI GLTLLKKKCR DLGIQRWPHR KFMSLDNLIE  180
NVKKLEKGEG NADEQRKKLE KLKKEKKRMK ESPDLEYEDK TKRLRQACYK ANHKRKRRLV  240
MSTSTA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1196207KKLEKLKKEKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0118096e-50AC011809.2 Arabidopsis thaliana chromosome I BAC F6A14 genomic sequence, complete sequence.
GenBankCP0026846e-50CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110765.10.0PREDICTED: protein RKD1
RefseqXP_013654475.10.0PREDICTED: protein RKD1
SwissprotQ9M9U96e-96RKD1_ARATH; Protein RKD1
TrEMBLM4DJ641e-168M4DJ64_BRARP; Uncharacterized protein
STRINGBra016542.1-P1e-167(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM39662356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.13e-84RWP-RK domain-containing protein